AV32439
Anti-OTX2 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Orthodenticle homeobox 2
Sign Into View Organizational & Contract Pricing
All Photos(3)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
32 kDa
species reactivity
human, bovine, dog, guinea pig, horse, rabbit, sheep, mouse, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... OTX2(5015)
General description
OTX2 is a homeodomain transcription factor that regulates organ development. Studies in mice have shown that Otx2 is involved in determining the fate of retinal photoreceptor cells. This transcription factor has also been implicated in pineal gland development.
Rabbit Anti-OTX2 antibody recognizes canine, chicken, human, mouse, rat, rabbit, zebrafish, and bovine OTX2.
Rabbit Anti-OTX2 antibody recognizes canine, chicken, human, mouse, rat, rabbit, zebrafish, and bovine OTX2.
Immunogen
Synthetic peptide directed towards the N terminal region of human OTX2
Application
Rabbit Anti-OTX2 antibody can be used for western blot applications at a concentration of 1.0-10.0μg/ml. It can also be used for IHC applications at 4-8μg/ml.
Biochem/physiol Actions
Homeobox protein OTX2 is a member of the bicoid sub-family of homeodomain-containing transcription factors. This protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined. This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined.
Sequence
Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Akihiro Nishida et al.
Nature neuroscience, 6(12), 1255-1263 (2003-11-20)
Understanding the molecular mechanisms by which distinct cell fate is determined during organogenesis is a central issue in development and disease. Here, using conditional gene ablation in mice, we show that the transcription factor Otx2 is essential for retinal photoreceptor
Bin-Bin Xie et al.
PloS one, 9(11), e112175-e112175 (2014-11-18)
The neural retina is a critical component of the visual system, which provides the majority of sensory input in humans. Various retinal degenerative diseases can result in the permanent loss of retinal neurons, especially the light-sensing photoreceptors and the centrally
M Krivega et al.
Reproduction (Cambridge, England), 148(5), 531-544 (2014-08-15)
Coxsackie virus and adenovirus receptor, CXADR (CAR), is present during embryogenesis and is involved in tissue regeneration, cancer and intercellular adhesion. We investigated the expression of CAR in human preimplantation embryos and embryonic stem cells (hESC) to identify its role
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service