Skip to Content
MilliporeSigma
All Photos(2)

Documents

AV34981

Sigma-Aldrich

Anti-GABRA3 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-γ-Aminobutyric acid (GABA) A receptor, α 3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

55 kDa

species reactivity

mouse, guinea pig, horse, human, rabbit, dog, rat, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GABRA3(2556)

General description

GABRA3 codes for the GABAA receptor α3 subunit. Genetic varaiations in GABRA3 have been linked to behavioural despair, bipolar affective disorders and thyrotoxic hypokalaemic periodic paralysis.
Rabbit Anti-GABRA3 antibody recognizes bovine, human, mouse, rat, and canine GABRA3.

Immunogen

Synthetic peptide directed towards the middle region of human GABRA3

Application

Rabbit Anti-GABRA3 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Sequence

Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Wallaya Jongjaroenprasert et al.
Clinical endocrinology, 68(4), 646-651 (2007-11-01)
Genetic predisposition has been suggested to play role in the pathogenesis of thyrotoxic hypokalaemic periodic paralysis (THPP). In this study, we assessed the differences of single-nucleotide polymorphisms (SNP) allelic frequency between THPP patients and well-characterized controls in order to find
I Massat et al.
Molecular psychiatry, 7(2), 201-207 (2002-02-13)
The available data from preclinical and pharmacological studies on the role of gamma amino butyric acid (GABA) support the hypothesis that a dysfunction in brain GABAergic system activity contributes to the vulnerability to bipolar affective disorders (BPAD). Moreover, the localization
Brooke H Miller et al.
Mammalian genome : official journal of the International Mammalian Genome Society, 21(5-6), 247-257 (2010-06-01)
The Tail Suspension Test (TST), which measures behavioral despair, is widely used as an animal model of human depressive disorders and antidepressant efficacy. In order to identify novel genes involved in the regulation of TST performance, we crossed an inbred

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service