Anti-PBEF1 (AB1) antibody produced in rabbit

Pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase (PBEF1, NAMPT, visfatin) is a rate limiting enzyme that promotes the salvage pathway biosynthesis of nicotinamide mononucleotide and nicotinamide dinucleotide (NAD) by catalyzing the condenstation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate. PBEF1 promotes B-cell maturation and vascular smooth muscle cell differentiaton. Visfatin/PBEF/Nampt is also a proinflammatory cytokine and marker of adipose tissue associated with systemic insulin resistance and hyperlipidemia. PBEF1 is a potential malignant astrocytoma serum marker and prognostic indicator among glioblastoma (GBM).

Anti-PBEF1 (AB1) polyclonal antibody reacts with chicken, zebrafish, human, mouse, rat, canine, and pig pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin proteins.

Synthetic peptide directed towards the C terminal region of human PBEF1

Anti-PBEF1 (AB1) polyclonal antibody is used to tag pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin in adipose tissue inflammation, as a cancer serum marker and as an NAD biosynthesis salvage pathway enzyme.

PBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity.

Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.