Skip to Content
MilliporeSigma
All Photos(2)

Documents

AV48056

Sigma-Aldrich

Anti-ST14 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-HAI, Anti-MT-SP1, Anti-MTSP-1, Anti-MTSP1, Anti-PRSS14, Anti-SNC19, Anti-Suppression of tumorigenicity 14 (colon carcinoma), Anti-TADG-15

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

mol wt

95 kDa

species reactivity

pig, human, mouse, bovine, rat, horse

packaging

pkg of 100 μL buffered aqueous solution
pkg of 50 μg lyophilized powder

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ST14(6768)

General description

Suppression of tumorigenicity 14 (colon carcinoma) (ST14) is an intergral membrane serine protease that forms a complex with HAI-1. It is known to inhibit cell growth and functions as a target for miR-27b. Mutations in ST14 have been linked to icthyosis.
Rabbit Anti-ST14 antibody recognizes human, mouse, rat, bovine, and rabbit ST14.

Immunogen

Synthetic peptide directed towards the C terminal region of human ST14

Application

Rabbit Anti-ST14 antibody is suitable for western blot applications at a concentration of 0.25 μg/ml and for IHC at 4-8 μg/ml.

Biochem/physiol Actions

ST14 is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.

Sequence

Synthetic peptide located within the following region: SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yanfang Wang et al.
The Journal of biological chemistry, 284(34), 23094-23106 (2009-06-24)
MicroRNAs are noncoding, endogenous small RNAs that regulate target genes by cleavage of the targeted mRNA or translational repression. We investigated the microRNAome using 2-color microarrays in a highly invasive human breast cancer cell line, MDA-MB-231 (subline 4175) and a
Thomas Alef et al.
The Journal of investigative dermatology, 129(4), 862-869 (2008-10-10)
Congenital ichthyosis encompasses a heterogeneous group of disorders of cornification. Isolated forms and syndromic ichthyosis can be differentiated. We have analyzed two consanguineous families from the United Arab Emirates and Turkey with an autosomal recessive syndrome of diffuse congenital ichthyosis

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service