Skip to Content
MilliporeSigma
All Photos(1)

Documents

HPA001275

Sigma-Aldrich

Anti-HIF1A antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ARNT-interacting protein antibody produced in rabbit, Anti-Basic-helix-loop-helix-PAS protein MOP1 antibody produced in rabbit, Anti-HIF-1 α antibody produced in rabbit, Anti-HIF1 α antibody produced in rabbit, Anti-Hypoxia-inducible factor 1 α antibody produced in rabbit, Anti-Member of PAS protein 1 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HIF1A(3091)

General description

The gene encoding HIF1A (hypoxia inducible factor 1 subunit α) is localized on human chromosome 14q23.2. It is part of the HIF-1 heterodimer complex and is modulated by oxygen.

Immunogen

Hypoxia-inducible factor 1 α recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Rabbit polyclonal anti-HIF1A antibody is used to tag hypoxia-inducible factor 1 α for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques such as immunoblotting, immunoprecipitation, and immunofluorescence. It is used as a probe to determine the presence and roles of hypoxia-inducible factor 1 α in the structure and function of hypoxia-inducible factor 1.

Biochem/physiol Actions

Hypoxia-inducible factor 1, α subunit (HIF1A) combines with aryl hydrocarbon receptor nuclear translocator (Arnt, HIF1B), the β subunit to create the heterodimeric basic helix-loop-helix transcription factor hypoxia-inducible factor 1. Many hypoxia-regulated genes are mediated by the hypoxia-inducible factor 1 (HIF-1) complex. HIF-1 binds to the promoter of hypoxia-responsive genes and other transcription factors, such as p300, signal and transducer of transcription 3, and redox effector factor 1/apurinic/apyrimidinic endonuclease.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70506

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Still not finding the right product?  

Give our Product Selector Tool a try.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Customers Also Viewed

Amalia Merelli et al.
Frontiers in neuroscience, 13, 750-750 (2019-08-06)
Erythropoietin (EPO) is not only a hormone that promotes erythropoiesis but also has a neuroprotective effect on neurons attributed to its known anti-apoptotic action. Previously, our group has demonstrated that recombinant-human EPO (rHu-EPO) can protect neurons and recovery motor activity
The correlation of prognostic biomarkers (Ki-67, Bcl-2, HIF-1alpha, cyclin D1) with metabolic tumor volume measured by F-FDG PET/CT inlaryngeal cancer
Eryilmaz A, et al.
Journal of Cancer Research and Therapeutics, 14(5), 994-994 (2018)
Blazej Zbytek et al.
Dermato-endocrinology, 5(2), 239-251 (2013-11-07)
Hypoxia-inducible factor-1α (HIF-1α) is a highly oxygen sensitive bHLH protein that is part of the heterodimeric HIF-1 transcription factor. Under hypoxic stress, HIF-1 activity is induced to control expression of multiple downstream target genes, including vascular endothelial growth factor (VEGF).
Identification of novel breast cancer risk loci
Chan CHT, et al.
Cancer Research, 77(19), 5428-5437 (2017)
L G Smyth et al.
Prostate cancer and prostatic diseases, 13(2), 178-181 (2009-12-30)
Tumour hypoxia is associated with over 70% of solid tumours including prostate and colorectal cancer. Hypoxia promotes tumour progression and resistance to treatment. Carbonic anhydrase IX (CA IX) is an endogenous marker of hypoxia. It is expressed in lung and

Articles

We present an article about how proliferating cells require the biosynthesis of structural components for biomass production and for genomic replication.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service