Skip to Content
MilliporeSigma
All Photos(6)

Documents

HPA004943

Sigma-Aldrich

Anti-SLCO1B3 antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-LST-2, Anti-Liver-specific organic anion transporter 2, Anti-OATP8, Anti-Organic anion transporter 8, Anti-Organic anion-transporting polypeptide 8, Anti-Solute carrier family 21 member 8, Anti-Solute carrier organic anion transporter family member 1B3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SLCO1B3(28234)

General description

The organic anion transporting polypeptides (OATPS) are membrane bound transporters belonging to the SLC (solute carrier) superfamily. SLCO1B3 (solute carrier organic anion transporter family, member 1B3) or OATP1B3 is a drug transporter, which belongs to the OATP1B subfamily. It is expressed in hepatocytes at the basolateral membrane. SLCO1B3 gene has two major single nucleotide polymorphisms (SNP) at exon 3 and 6, and these polymorphic variations determine the characteristics of the transportations of various substrates. The gene is located in the chromosomal region 12p12.

Immunogen

Solute carrier organic anion transporter family member 1B3 recombinant protein epitope signature tag (PrEST)

Application

Anti-SLCO1B3 antibody is suitable for immunocytochemistry.
Anti-SLCO1B3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

SLCO1B3 (solute carrier organic anion transporter family, member 1B3) plays a major role in the uptake and clearance of a broad range of drugs and drug metabolites in liver. SLCO1B3 is also responsible for the uptake of the cancer drugs- paclitaxel and docetaxel. It has been suggested that, in humans, ABCC3, OATP1B1, and SLCO1B3 form a liver- blood shuttle, where ABCC3 secretes the bilirubin glucoronide conjugates in the blood, which is then reabsorbed back to liver by OATP1B1 and SLCO1B3. Any deficiency in SLCO1B3 may therefore, be implicated in Rotor Syndrome or Rotor type hyperbilirubinemia. It mediates uptake of steroid hormones such as testosterone, and is found to be overexpressed in prostate cancer tissue as compared to normal tissue. SNPs in the gene SLCO1B3 determine the prognosis and survival in prostate cancer patients.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86073

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Henriette E Meyer Zu Schwabedissen et al.
Diabetes, 63(2), 775-784 (2013-10-24)
Organic anion transporting polypeptide OATP1B3 is a membrane-bound drug transporter that facilitates cellular entry of a variety of substrates. Most of the previous studies focused on its hepatic expression and function in hepatic drug elimination. In this study, we report
Qing Zhu et al.
Drug metabolism letters, 7(2), 117-125 (2014-03-19)
Human hepatic organic anion-transporting polypeptides (OATPs), including OATP1B1, 1B3, and 2B1, are expressed at the basolateral membrane of hepatocytes and mediate the uptake of a variety of compounds from blood into hepatocytes. The liver-specific OATPs are increasingly recognized as playing
Yuchen Sun et al.
Clinical and translational medicine, 3, 37-37 (2015-01-28)
We have previously identified the cancer-type organic anion transporting polypeptide 1B3 (Ct-OATP1B3) mRNA in several human colon and lung cancer tissues. Ct-OATP1B3 is a variant of the liver-type OATP1B3 (Lt-OATP1B3) mRNA, which is a hepatocyte plasma membrane transporter with broad
Loss of organic anion transporting polypeptide 1B3 function causes marked delay in indocyanine green clearance without any clinical symptoms.
Tatehiro Kagawa et al.
Hepatology (Baltimore, Md.), 65(3), 1065-1068 (2016-11-20)
Tomomi Furihata et al.
Antimicrobial agents and chemotherapy, 58(8), 4555-4564 (2014-05-29)
Simeprevir (SMV), asunaprevir (ASV), daclatasvir (DCV), and sofosbuvir (SFV), which are newly developed direct-acting antiviral agents (DAAs) against hepatitis C virus (HCV) infection, are among the key components of anti-HCV regimens. Preclinical studies have identified inhibitory properties for some of

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service