Skip to Content
MilliporeSigma
All Photos(2)

Documents

HPA051171

Sigma-Aldrich

Anti-FKBP10 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-FK506 binding protein 10, 65 kDa, Anti-FKBP6, Anti-FLJ20683, Anti-FLJ22041, Anti-FLJ23833, Anti-hFKBP65

Sign Into View Organizational & Contract Pricing
All Photos(2)

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA051171
NACRES:
NA.43

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

CSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSRED

UniProt accession no.

Q96AY3

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FKBP10(60681)

General description

FK506 binding protein 10 (FKBP10) is expressed in the endoplasmic reticulum. It is a peptidyl-prolyl cis-trans isomerase, with a molecular weight of 65kDa. The gene encoding this protein is localized on human chromosome 17q21.2.

Immunogen

FK506 binding protein 10, 65 kDa recombinant protein epitope signature tag (PrEST)

Application

Anti-FKBP10 antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

FK506 binding protein 10 (FKBP10) is a chaperone protein. It is thought to be a chaperone of type I collagen. Mutations in the FKBP10 gene have been linked to Bruck syndrome, which is characterized by bone fragility and congenital joint contractures.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85546

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Kuskokwim syndrome, a recessive congenital contracture disorder, extends the phenotype of FKBP10 mutations
Aileen M. Barnes
Human Mutation, 34(9), 1279?1288-1279?1288 (2013)
Bruck syndrome - a rare syndrome of bone fragility and joint contracture and novel homozygous FKBP10 mutation.
Moravej H, et. Al
Endokrynologia Polska, 66(2), 170-174 (2015)
Integration of zebrafish fin regeneration genes with expression data of human tumors in silico uncovers potential novel melanoma markers
Martin Hagedorn
Oncotarget, 7(44), 71567?71579-71567?71579 (2016)
Osama H Essawi et al.
European journal of medical genetics, 63(9), 103980-103980 (2020-06-13)
To date 45 autosomal recessive disease-causing variants are reported in the FKBP10 gene. Those variant were found to be associated with Osteogenesis Imperfecta (OI) for which the hallmark phenotype is bone fractuers or Bruck Syndrome (BS) where bone fractures are
Michael C J Quinn et al.
International journal of oncology, 42(3), 912-920 (2013-01-29)
The frequent loss of chromosome 17 in epithelial ovarian carcinomas (EOC), particularly high-grade serous carcinomas (HGSC), has been attributed to the disruption of TP53 (at 17p13.1) and other chromosome 17 genes suspected to play a role in tumour suppressor pathways.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service