Skip to Content
MilliporeSigma
All Photos(1)

Documents

HPA060499

Sigma-Aldrich

Anti-SOX5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody

Synonym(s):

L-SOX5, MGC35153

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL

immunogen sequence

VEEEESDGLPAFHLPLHVSFPNKPHSEEFQPVSLLTQETCGHRTPTSQHNTMEVDGNKVMSSFAPHNSSTSPQKAEEGGRQSGESLSSTALG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SOX5(6660)

General description

Sex determining region Y(SRY) HMG (High mobility group) box 5 (SOX5) belongs to the family of transcription factors which is involved in early developmental stage. Sox proteins are classified into 6 subfamily groups based on their homology and SOX5 belongs to subfamily D. The group D subfamily share a conserved N terminal domain which has leucine zipper, coiled-coil domain, Glutamine rich region (Q box).Sox5 has two variants, long and short, of which, short is a part of long with N-terminal region. Short form of Sox5 is expressed in testis and long form of Sox5 (LSox5) is expressed different organs including chondrocytes and striated muscles. LSox5 and Sox6 are highly similar. In human chromosome, the gene is localized on 12p12.1.

Immunogen

SRY (sex determining region Y)-box 5

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

SOX5 (Sry-type HMG box 5) is involved in the development of cartilage and skeletal muscles. Sox5 and Sox6 along with Sox9 regulates chondrocyte differentiation. Mutations in SOX5 leads to deformity of skeletal muscles. Inactivation of Sox5 leads to death of the baby at birth due to respiratory distress. The short form of Sox5 is involved in spermatid cells differentiation and spermiogenesis in the testis. Sox5 is also involved in the development of certain neuronal cell types. Haploinsufficiency or deletion of Sox5 leads to intellectual disability and developmental delays.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST89908

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Coamplification of DAD-R, SOX5, and EKI1 in human testicular seminomas, with specific overexpression of DAD-R, correlates with reduced levels of apoptosis and earlier clinical manifestation
Zafarana G, et al.
Cancer Research, 62(6), 1822-1831 (2002)
Twenty pairs of Sox: extent, homology, and nomenclature of the mouse and human Sox transcription factor gene families
Schepers GE, et al.
Developmental Cell, 3(2), 167-170 (2002)
Deletion 12p12 involving SOX5 in two children with developmental delay and dysmorphic features
Lee RW, et al.
Pediatric Neurology, 48(4), 317-320 (2013)
Chondrogenesis of human mesenchymal stem cells mediated by the combination of SOX trio SOX5, 6, and 9 genes complexed with PEI-modified PLGA nanoparticles
Park JS, et al.
Biomaterials, 32(14), 3679-3688 (2011)
L-Sox5, Sox6 and Sox9 control essential steps of the chondrocyte differentiation pathway
Lefebvre V, et al.
Osteoarthritis and Cartilage, 9, S69-S75 (2001)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service