AV45622
Anti-RORC (AB2) antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-MGC129539, Anti-NR1F3, Anti-RAR-related orphan receptor C, Anti-RORG, Anti-RZRG, Anti-TOR
Sign Into View Organizational & Contract Pricing
All Photos(2)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
56 kDa
species reactivity
guinea pig, horse, human, rat, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... RORC(6097)
General description
The previously assigned protein identifier Q5SZR9 has been merged into P51449. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the N terminal region of human RORC
Application
Anti-RORC (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
Retinoic acid related orphan receptor C (RORC), a member of the retinoid-related orphan family of nuclear receptors, is a ligand-dependent transcription factor. RORs have important roles in development, immunity and maintenance of circadian rhythm and metabolism. RORC may be involved in lymphoid organogenesis and thymopoiesis.
Sequence
Synthetic peptide located within the following region: EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Anton M Jetten
Nuclear receptor signaling, 7, e003-e003 (2009-04-22)
The last few years have witnessed a rapid increase in our knowledge of the retinoid-related orphan receptors RORalpha, -beta, and -gamma (NR1F1-3), their mechanism of action, physiological functions, and their potential role in several pathologies. The characterization of ROR-deficient mice
Ivan Dzhagalov et al.
Cellular & molecular immunology, 1(6), 401-407 (2005-11-19)
Hormones and their receptors regulate cell growth, differentiation and apoptosis and also play important roles in immune function. Recent studies on the subfamily of the orphan nuclear receptors known as retinoid-acid related orphan receptors (ROR) have shed important insights on
Shoki Sato et al.
Oncology reports, 32(6), 2753-2759 (2014-10-14)
The disease frequency of pancreatic neuroendocrine tumors (PNETs) has been growing, and postoperative hepatic recurrence (PHR) is one of the factors affecting patient prognosis. The present study aimed to investigate biomarkers of PNETs in the primary disease site to predict
Matthew B Carlin et al.
The Journal of nutrition, 144(9), 1409-1414 (2014-07-25)
Essential amino acids (EAAs) are potent stimulators of mechanistic target of rapamycin complex 1 (mTORC1) signaling and muscle protein synthesis. However, regulators upstream of mTORC1 that are responsive to EAA availability are not well described, especially in human skeletal muscle.
Zhen He et al.
Oncology reports, 32(5), 1873-1880 (2014-09-02)
Chronic inflammation is an underlying risk factor for colorectal cancer. No direct evidence has proven that inflammation in the colon promotes carcinogenesis. STAT3 plays an important role in the development of colitis-associated colorectal cancer (CAC). There is crosstalk between the
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service