Skip to Content
MilliporeSigma
All Photos(1)

Documents

SAB2102776

Sigma-Aldrich

Anti-ZFYVE1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-DFCP1, Anti-KIAA1589, Anti-TAFF1, Anti-ZNFN2A1, Anti-Zinc finger, FYVE domain containing 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

87 kDa

species reactivity

dog, human, guinea pig, horse, mouse, rat, rabbit, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZFYVE1(53349)

General description

Zinc finger FYVE-type containing 1 (ZFYVE1) encodes a 777 amino acid protein, which consists a N terminal Cys-His cluster homologous to zinc finger domains and two zinc-binding FYVE domains at the C terminal. It also contains an ATP/GTP binding site. ZFYVE1 gene is located on human chromosome 14q22-q24.

Immunogen

Synthetic peptide directed towards the C terminal region of human ZFYVE1

Biochem/physiol Actions

ZFYVE1 contains two zinc-binding FYVE domains in tandem. This protein binds to phosphatidylinositol-3-phosphate (PtdIns3P) through its FYVE-type zinc finger. It displays a predominantly Golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes.The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. This gene encodes a protein which contains two zinc-binding FYVE domains in tandem. This protein displays a predominantly Golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes. Zinc finger FYVE-type containing 1 (ZFYVE1) organizes the endoplasmic reticulum around the phagophore to form a cradle like structure, which is called as an omegasome.

Sequence

Synthetic peptide located within the following region: VCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Genetic aberrations in macroautophagy genes leading to diseases
van Beek N, et al.
Biochimica et Biophysica Acta - Molecular Cell Research (2018)
A R Derubeis et al.
Gene, 255(2), 195-203 (2000-10-12)
Double FYVE-containing protein 1 (DFCP1) encodes a 777 amino acid protein that contains: (1) an N-terminal Cys-His cluster with some homology to many zinc finger domains; (2) a consensus sequence consistent with an ATP/GTP binding site; and (3) a C-terminal

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service